HORDB

ID: hor002953
Uniprot ID: P91302
Protein name: Ubiquitin-like protein 5
Gene name: ubl-5
Organism: Caenorhabditis elegans
Family: NA
Source: Animal
Expression: Expression increased by citrate dietary supplementation.
Disease: NA
Comments: NA
Taxonomy: Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0031386 protein tag activity
GO BP: GO:0000398 mRNA splicing, via spliceosome; GO:0010628 positive regulation of gene expression; GO:0034514 mitochondrial unfolded protein response; GO:0036211 protein modification process
GO CC: GO:0005634 nucleus; GO:0005667 transcription regulator complex; GO:0005737 cytoplasm; GO:0005829 cytosol

Sequence: MIEITVNDRLGKKVRIKCNPSDTIGDLKKLIAAQTGTRWEKIVLKKWYTIYKDHITLMDYEIHEGFNFELYYQ
Length: 73(1-73)
Propeptide: MIEITVNDRLGKKVRIKCNPSDTIGDLKKLIAAQTGTRWEKIVLKKWYTIYKDHITLMDYEIHEGFNFELYYQ
Signal peptide: NA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Involved in the mitochondrial unfolded protein response (mtUPR) (PubMed:17925224). Plays a role in modulation of lipid metabolism in response to the citrate-induced mtUPR, acting upstream of transcription factor nhr-80 (PubMed:35021096).
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

AF-Q6IWB2-F1.pdb

hor002953_AF2.pdb

hor002953_ESM.pdb

Mass:	1002265	Formula:	C400H628N102O111S3
Absent amino acids:		Common amino acids:	IK
pI:	9.01	Basic residues:	14
Polar residues:	20	Hydrophobic residues:	24
Hydrophobicity:	-44.66	Boman Index:	-12230
Half-Life:	30 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	94.79
Instability Index:	2167.26	Extinction Coefficient cystines:	18450
Absorbance 280nm:	256.25